PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01775.1.g00070.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 121aa    MW: 13627.7 Da    PI: 9.9654
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01775.1.g00070.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF59.63.8e-19942134
                                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-E CS
                          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdae 34
                                    +ri+n +nrqvtfskRr g++KKA EL +LCda+
  Zpz_sc01775.1.g00070.1.sm.mkhc  9 ERIDNRTNRQVTFSKRRSGLMKKARELGILCDAD 42
                                    69******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.27E-19145IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-19156IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.591146IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-16323IPR002100Transcription factor, MADS-box
PfamPF003193.6E-171042IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-162338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MGRGKIAIER IDNRTNRQVT FSKRRSGLMK KARELGILCD ADEQLLADEI IQLNQKGLAL  60
QKENIELKKE VGIVHRHKME LQKKLYASEG QSTSGDCKHA SGASSEKGQD VVFPMNHLRI  120
D
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015934956.11e-24PREDICTED: agamous-like MADS-box protein AGL16 isoform X5
TrEMBLK7M1V31e-20K7M1V3_SOYBN; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3415534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.11e-18AGAMOUS-like 44